DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Y54F10BM.13

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_497538.1 Gene:Y54F10BM.13 / 190277 WormBaseID:WBGene00021867 Length:227 Species:Caenorhabditis elegans


Alignment Length:197 Identity:60/197 - (30%)
Similarity:89/197 - (45%) Gaps:35/197 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ETSEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCD----EVYPGIYIGDAAAAKNKTYL 92
            :|:|..:.|:.::|.:..          ||.  .|.|::.|    |..|.:..|....|.:...|
 Worm    52 KTTENISNRRRKKVEYLQ----------RRG--FIVDLEPDLVVGEALPDLLFGSQDVAADLPIL 104

  Fly    93 RLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVAS 157
            ....|||::|...|               :|    :|....|.|:...::|.|.|.|..||....
 Worm   105 ENRKITHIVNVGTG---------------IP----NHFPKKFEYLQIDILDLPETRIIDYFERVF 150

  Fly   158 KFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPNDGFLQQLAD 222
            :|||....:.|.:.:||..|:|||||.|:||||...|:|..:|:...|..|.||||.||.|||.:
 Worm   151 EFIDKVRQNEGIVFIHCNAGISRSATFVVAYLMKNLKISCREAMDKCRETRSIRPNTGFAQQLKE 215

  Fly   223 LD 224
            .:
 Worm   216 YE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 52/158 (33%)
Y54F10BM.13NP_497538.1 DSPc 87..217 CDD:238073 50/148 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.