DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and DUSP9

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_011529425.1 Gene:DUSP9 / 1852 HGNCID:3076 Length:415 Species:Homo sapiens


Alignment Length:157 Identity:52/157 - (33%)
Similarity:80/157 - (50%) Gaps:18/157 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYM 137
            ::.|.:|:|.|..:.|...|..:||.::||...               ::|:....:.|  |.|.
Human   237 QILPNLYLGSARDSANLESLAKLGIRYILNVTP---------------NLPNFFEKNGD--FHYK 284

  Fly   138 GFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIR 202
            ..|:.|..:.::||:|..|.:|||.|:|....:|||||.|:|||.|..:||||....:|..||..
Human   285 QIPISDHWSQNLSRFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTVTVAYLMQKLHLSLNDAYD 349

  Fly   203 TV-RMRRDIRPNDGFLQQLADLDMELK 228
            .| |.:.:|.||..|:.||.|.:..|:
Human   350 LVKRKKSNISPNFNFMGQLLDFERSLR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 51/154 (33%)
DUSP9XP_011529425.1 DSP_MapKP 38..169 CDD:238723
CDC14 224..373 CDD:225297 51/152 (34%)
DSPc 235..372 CDD:238073 51/151 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.