DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and DUSP5

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_004410.3 Gene:DUSP5 / 1847 HGNCID:3071 Length:384 Species:Homo sapiens


Alignment Length:158 Identity:52/158 - (32%)
Similarity:76/158 - (48%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCV--FR 135
            |:.|.:|:|.|..|....:|..:.||.:||.:                     ||:.:.|.  ..
Human   181 EILPFLYLGSAYHASKCEFLANLHITALLNVS---------------------RRTSEACATHLH 224

  Fly   136 YMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDA 200
            |...|:.|:.|.|||.:|..|..|||.....|||:||||..|:|||.|..:||||..::....:|
Human   225 YKWIPVEDSHTADISSHFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTKQFRLKEA 289

  Fly   201 IRTVRMRRD-IRPNDGFLQQLADLDMEL 227
            ...::.||. :.||.||:.||...:.|:
Human   290 FDYIKQRRSMVSPNFGFMGQLLQYESEI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 51/156 (33%)
DUSP5NP_004410.3 DSP_MapKP 5..140 CDD:238723
Nuclear localization signal. /evidence=ECO:0000255 53..74
DSPc 178..314 CDD:238073 51/153 (33%)
CDC14 <227..311 CDD:225297 35/83 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.