DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and DUSP3

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_004081.1 Gene:DUSP3 / 1845 HGNCID:3069 Length:185 Species:Homo sapiens


Alignment Length:161 Identity:69/161 - (42%)
Similarity:97/161 - (60%) Gaps:11/161 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFR 135
            |:||.|.||:|:|:.|::...|:.:|||||||||||..:..|:|..::|          ||....
Human    30 CNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFY----------KDSGIT 84

  Fly   136 YMGFPMVDAPTTDISRYFYVASKFIDSAIS-SGGKILVHCLVGMSRSATCVLAYLMICRKMSAVD 199
            |:|....|....::|.||..|:.|||.|:: ..|::||||..|.|||.|.|:||||:.:||....
Human    85 YLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKS 149

  Fly   200 AIRTVRMRRDIRPNDGFLQQLADLDMELKRK 230
            |:..||..|:|.||||||.||..|:..|.::
Human   150 ALSIVRQNREIGPNDGFLAQLCQLNDRLAKE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 68/156 (44%)
DUSP3NP_004081.1 DUSP3 10..177 CDD:350427 68/156 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2969
OMA 1 1.010 - - QHG45754
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.