DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and DUSP2

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_016859035.1 Gene:DUSP2 / 1844 HGNCID:3068 Length:342 Species:Homo sapiens


Alignment Length:187 Identity:60/187 - (32%)
Similarity:91/187 - (48%) Gaps:27/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SMAPSRALP------GLRRAECAIHDVDCD-EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEG 106
            |.||:.|||      ....:...::|.... |:.|.:::|..:.:.:...|:..|||.|||.:..
Human   172 SEAPAPALPPTGDKTSRSDSRAPVYDQGGPVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSAS 236

  Fly   107 CRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKIL 171
            |                   .:|.:.:|||...|:.|....:||.:|..|..|||...:|||::|
Human   237 C-------------------PNHFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSGGRVL 282

  Fly   172 VHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRD-IRPNDGFLQQLADLDMEL 227
            |||..|:|||||..|||||..|::...:|...|:.||. |.||..|:.||...:.::
Human   283 VHCQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQV 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 53/157 (34%)
DUSP2XP_016859035.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.