DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and DUSP2

DIOPT Version :10

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_054196891.1 Gene:DUSP2 / 1844 HGNCID:3068 Length:390 Species:Homo sapiens


Alignment Length:187 Identity:60/187 - (32%)
Similarity:91/187 - (48%) Gaps:27/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SMAPSRALP------GLRRAECAIHDVDCD-EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEG 106
            |.||:.|||      ....:...::|.... |:.|.:::|..:.:.:...|:..|||.|||.:..
Human   220 SEAPAPALPPTGDKTSRSDSRAPVYDQGGPVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSAS 284

  Fly   107 CRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKIL 171
            |                   .:|.:.:|||...|:.|....:||.:|..|..|||...:|||::|
Human   285 C-------------------PNHFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSGGRVL 330

  Fly   172 VHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRD-IRPNDGFLQQLADLDMEL 227
            |||..|:|||||..|||||..|::...:|...|:.||. |.||..|:.||...:.::
Human   331 VHCQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQV 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 53/157 (34%)
DUSP2XP_054196891.1 DSP_MapKP 56..219 CDD:238723
DSP_DUSP2 246..389 CDD:350489 53/161 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.