DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp8

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_032774.1 Gene:Dusp8 / 18218 MGIID:106626 Length:663 Species:Mus musculus


Alignment Length:190 Identity:59/190 - (31%)
Similarity:84/190 - (44%) Gaps:32/190 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SRALPGLRRAECA-------------IHDVDCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAA 104
            |...|||...:.|             :..|....:.|.:|:|......||..:...||::||||:
Mouse   130 SSCFPGLCEGKPATLPSMSLSQPCLPVPSVGLTRILPHLYLGSQKDVLNKDLMTQNGISYVLNAS 194

  Fly   105 EGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGK 169
            ..|             ..|..     .|..|:|..|:.|.....:..:...:.:|||.|..|..:
Mouse   195 NSC-------------PKPDF-----ICESRFMRIPINDNYCEKLLPWLDKSIEFIDKAKLSSCQ 241

  Fly   170 ILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRR-DIRPNDGFLQQLADLDMELK 228
            ::||||.|:|||||..:||:|....||:.||.|.|:.|| .|.||..||.||.:.:..||
Mouse   242 VIVHCLAGISRSATIAIAYIMKTMGMSSDDAYRFVKDRRPSISPNFNFLGQLLEYERSLK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 51/156 (33%)
Dusp8NP_032774.1 DSP_MapKP 10..137 CDD:238723 3/6 (50%)
DSP_DUSP8 150..300 CDD:350493 52/167 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..367
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 404..624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.