DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and F13D11.3

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_508975.2 Gene:F13D11.3 / 180847 WormBaseID:WBGene00017428 Length:174 Species:Caenorhabditis elegans


Alignment Length:161 Identity:43/161 - (26%)
Similarity:73/161 - (45%) Gaps:32/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KNKTYLRLMGI-THVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHK-----DC----VFRYMGFPM 141
            :||..|.:..: .|:..|..||             ..||:.:.:.     ||    .....|...
 Worm     4 QNKALLSITQVRPHLFLAGYGC-------------ITPSLLKQYNITHGVDCTNLKTKPIKGLDR 55

  Fly   142 VDAPTTD-----ISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDA- 200
            ::.|..|     |::||....|:|:.|...|...:::|..|:|||||..:.|||:...:|..:| 
 Worm    56 IEVPVDDNTLAKITQYFEPVVKYIEDAKQQGHNTVIYCAAGVSRSATLTIVYLMVTENLSLEEAY 120

  Fly   201 IRTVRMRRDIRPNDGFLQQLADLDMELKRKN 231
            ::..::|..|.||.||.:|:.|.:   |::|
 Worm   121 LQVNQVRPIISPNIGFWRQMIDFE---KQRN 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 41/155 (26%)
F13D11.3NP_508975.2 DSPc 11..146 CDD:214551 38/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.