DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and C24F3.2

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_501870.1 Gene:C24F3.2 / 177903 WormBaseID:WBGene00007697 Length:272 Species:Caenorhabditis elegans


Alignment Length:118 Identity:33/118 - (27%)
Similarity:49/118 - (41%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 AEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGG 168
            :|..:.|.||....:..|||                   |.|..| :.....|..:|:..:....
 Worm    42 SEKQKIGGVDYKFLHLLDMP-------------------DEPILD-NAILETAVLYINEGVEKEE 86

  Fly   169 KILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVR-MRRDIRPNDGFLQQL 220
            .:.||||..:|||.:...||||...:.....|::.:. :|:.|.||.|||.||
 Worm    87 NVGVHCLAAVSRSVSICAAYLMYKNQWPVEKALKMIESVRKTIGPNAGFLAQL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 33/118 (28%)
C24F3.2NP_501870.1 DSPc 3..143 CDD:238073 33/118 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.