DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Dusp5

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_598262.2 Gene:Dusp5 / 171109 RGDID:620854 Length:384 Species:Rattus norvegicus


Alignment Length:158 Identity:52/158 - (32%)
Similarity:76/158 - (48%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCV--FR 135
            |:.|.:|:|.|..|....:|..:.||.:||.:                     ||:.:.|.  ..
  Rat   181 EILPFLYLGSAYHASKCEFLANLHITALLNVS---------------------RRTSEACTTHLH 224

  Fly   136 YMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDA 200
            |...|:.|:.|.|||.:|..|..|||.....|||:||||..|:|||.|..:||||..::....:|
  Rat   225 YKWIPVEDSHTADISSHFQEAIDFIDCVREEGGKVLVHCEAGVSRSPTICMAYLMKTKQFRLKEA 289

  Fly   201 IRTVRMRRD-IRPNDGFLQQLADLDMEL 227
            ...::.||. :.||.||:.||...:.|:
  Rat   290 FEYIKQRRSVVSPNFGFMGQLLQYESEI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 51/156 (33%)
Dusp5NP_598262.2 DSP_MapKP 5..140 CDD:238723
Nuclear localization signal. /evidence=ECO:0000255 53..74
DSP_DUSP5 179..316 CDD:350487 51/155 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.