DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Epm2a

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001263691.1 Gene:Epm2a / 114005 RGDID:71047 Length:331 Species:Rattus norvegicus


Alignment Length:187 Identity:37/187 - (19%)
Similarity:65/187 - (34%) Gaps:53/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HYYQSPSRLETSEQTT-------GRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCDEVYPGIYI 80
            |:.::.......:.||       |.|   .:|||                       .:.|.|::
  Rat   128 HWIEATGHTNEMKHTTDFYFNIAGHQ---AMHYS-----------------------RILPNIWL 166

  Fly    81 GDAAAAKNKTYLRL---MGITHVLN---------AAEGC-RYGQVDTGHSYYRDMPSIRRSHKDC 132
            |..........::|   :|||.|:|         .:.|| ||.:..|       ..::.:.:|:.
  Rat   167 GSCPRQLEHVTIKLKHELGITAVMNFQTEWDIIQNSSGCNRYPEPMT-------PDTMMKLYKEE 224

  Fly   133 VFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYL 189
            ...|:..|..|..|....:....|...:.:.:.:|..:.|||..|:.||...|..:|
  Rat   225 GLAYIWMPTPDMSTEGRVQMLPQAVCLLHALLENGHTVYVHCNAGVGRSTAAVCGWL 281

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 29/132 (22%)