DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and DUSP12

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_009171.1 Gene:DUSP12 / 11266 HGNCID:3067 Length:340 Species:Homo sapiens


Alignment Length:165 Identity:50/165 - (30%)
Similarity:78/165 - (47%) Gaps:19/165 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PGLRRAECAIHDVDCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRD 121
            |...|..||...:   ||.||:|.|.|||.....:||..|||.||.         ||:....::.
Human    16 PSASRVSCAGQML---EVQPGLYFGGAAAVAEPDHLREAGITAVLT---------VDSEEPSFKA 68

  Fly   122 MPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVL 186
            .|.:     :.::| :..|.:|.|.||:..:......||..|.:.|..:||||..|:|||...:.
Human    69 GPGV-----EDLWR-LFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAIIT 127

  Fly   187 AYLMICRKMSAVDAIRTVR-MRRDIRPNDGFLQQL 220
            |:||...::....|...:: ::.:.:.|:||..||
Human   128 AFLMKTDQLPFEKAYEKLQILKPEAKMNEGFEWQL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 46/151 (30%)
DUSP12NP_009171.1 DSPc 26..166 CDD:238073 46/155 (30%)
Substrate binding. /evidence=ECO:0000305|PubMed:24531476, ECO:0007744|PDB:4KI9 116..121 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.