DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and si:ch211-203d1.3

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_021328548.1 Gene:si:ch211-203d1.3 / 101886694 ZFINID:ZDB-GENE-160113-15 Length:607 Species:Danio rerio


Alignment Length:215 Identity:59/215 - (27%)
Similarity:86/215 - (40%) Gaps:62/215 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RLETSEQTTGRQLQRVLH-------------------YSMA----PSRALPGLRRAECAIHDVDC 71
            |.|..|..|.:|::..|.                   .:||    |||.|..|            
Zfish   255 RTEDLENITSKQVRTSLESRIGIDMKDYKEYIDNEMMVTMAQMDKPSRILDYL------------ 307

  Fly    72 DEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRY 136
                   |:|....|.|...|:...:.::||..                  ..|.....:| |.|
Zfish   308 -------YLGSEWNAANFEELQKNNVGYILNVT------------------MEIDNFFPEC-FTY 346

  Fly   137 MGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAI 201
            |...:.|...||:..::.....||:.|..||..:||||.:|:||||:.|:|:||..:..:...|:
Zfish   347 MNIRVYDVEATDLLSHWNNTYMFINEARKSGQAVLVHCKMGVSRSASTVIAFLMKQQGWTLDQAL 411

  Fly   202 RTVRMRRDI-RPNDGFLQQL 220
            ..||.||.| :||:|||:||
Zfish   412 NHVRERRPIVQPNEGFLKQL 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 46/151 (30%)
si:ch211-203d1.3XP_021328548.1 SSH-N 3..230 CDD:212166
DEK_C 243..294 CDD:312337 6/38 (16%)
DSPc 299..434 CDD:238073 51/171 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.