DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and Styx

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001258470.1 Gene:Styx / 100912536 RGDID:1594806 Length:223 Species:Rattus norvegicus


Alignment Length:158 Identity:54/158 - (34%)
Similarity:87/158 - (55%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DCDEVYPGIYIGD-AAAAKNK-TYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDC 132
            :..||.||:::|. ::|.|:| ..|:..||||::     |....::....    .|:.::     
  Rat    28 EMQEVLPGLFLGPYSSAMKSKLPILQKHGITHII-----CIRQNIEANFI----KPNFQQ----- 78

  Fly   133 VFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSA 197
            :|||:...:.|.|..:|.|:|.:..:|||.::.:|||:|||...|:||||..|:||:|....|..
  Rat    79 LFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQNGGKVLVHGNAGISRSAAFVIAYIMETFGMKY 143

  Fly   198 VDAIRTVRMRR-DIRPNDGFLQQLADLD 224
            .||...|:.|| .|.||.||:.||.:.:
  Rat   144 RDAFAYVQERRFCINPNAGFVHQLQEYE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 54/157 (34%)
StyxNP_001258470.1 DSP_STYX 25..175 CDD:350372 54/158 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.