DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and LOC100537679

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_003199724.5 Gene:LOC100537679 / 100537679 -ID:- Length:160 Species:Danio rerio


Alignment Length:147 Identity:63/147 - (42%)
Similarity:83/147 - (56%) Gaps:14/147 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 AKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDIS 150
            |:|::.|:.:||||:||||...| |.:. ...||...           |.|.|.|..|....|:.
Zfish    21 AQNRSALQQLGITHILNAAHSKR-GSIG-DQQYYGSS-----------FVYCGIPADDNTHFDLD 72

  Fly   151 RYFYVASKFIDSAI-SSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPND 214
            .||..|:.||..|: |..||:||||::|||||:|.||||||:...|....|||.:..:|.|.||.
Zfish    73 VYFKPAADFIHRALHSPDGKVLVHCIMGMSRSSTLVLAYLMLYHDMPLHTAIRRIIRKRAIYPNR 137

  Fly   215 GFLQQLADLDMELKRKN 231
            .||..|.|||::.|||:
Zfish   138 NFLALLLDLDLQRKRKH 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 60/141 (43%)
LOC100537679XP_003199724.5 PTPc 21..>120 CDD:328744 47/111 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45754
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0000750
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.