DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp3

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_002937631.1 Gene:dusp3 / 100498529 XenbaseID:XB-GENE-961523 Length:184 Species:Xenopus tropicalis


Alignment Length:164 Identity:71/164 - (43%)
Similarity:92/164 - (56%) Gaps:15/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRY 136
            :||:|.||:|||...:|...||.:.|||::|||||..:..|:|..:||          ......|
 Frog    30 NEVFPKIYVGDAVIVQNVMRLRRLRITHIINAAEGNSFMHVNTNAAYY----------SGTGIAY 84

  Fly   137 MGFPMVDAPTTDISRYFYVASKFIDSAIS-SGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDA 200
            :|....|....|:|.||..||.||..|:| ..|::.|||..|.|||.|.|:||||..:||....|
 Frog    85 LGIKADDTQHFDLSVYFEEASDFISQALSQKDGRVFVHCREGYSRSPTLVVAYLMRHQKMDVKTA 149

  Fly   201 IRTVRMRRDIRPNDGFLQQLAD----LDMELKRK 230
            :.|||.:|:|.||||||:||..    ||.|.|.|
 Frog   150 LTTVRQKREIGPNDGFLKQLCQYNEKLDRERKDK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 68/159 (43%)
dusp3XP_002937631.1 DUSP3 9..176 CDD:350427 66/155 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45754
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.