DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and ssh1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_002932127.2 Gene:ssh1 / 100495893 XenbaseID:XB-GENE-6041963 Length:975 Species:Xenopus tropicalis


Alignment Length:163 Identity:49/163 - (30%)
Similarity:77/163 - (47%) Gaps:24/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMG 138
            ::..:|:|....|.|...|...|:.::||...     ::|   :::..|           |.|..
 Frog   310 IFDHVYLGSEWNASNLEELHSTGVGYILNVTR-----EID---NFFPGM-----------FAYHN 355

  Fly   139 FPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRT 203
            ..:.|..|||:..::..|..||..|..:..|.||||.:|:||||:.|:||.|.....|...|...
 Frog   356 IRVYDEETTDLLSHWNDAYHFITKAKKNKSKCLVHCKMGVSRSASTVIAYAMKENGWSMEKAYNF 420

  Fly   204 VRMRRDI-RPNDGFLQQLAD----LDMELKRKN 231
            |:.:|.: |||.||::||.:    ||...:|.|
 Frog   421 VKQKRSVTRPNAGFMRQLLEYEGILDASKQRHN 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 47/157 (30%)
ssh1XP_002932127.2 SSH-N 3..235 CDD:212166
DEK_C 249..301 CDD:400903
DSP_slingshot_1 304..447 CDD:350418 46/155 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.