DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp13

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_002937175.1 Gene:dusp13 / 100492068 XenbaseID:XB-GENE-940215 Length:209 Species:Xenopus tropicalis


Alignment Length:213 Identity:84/213 - (39%)
Similarity:117/213 - (54%) Gaps:30/213 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GDRYSPHYYQSPSRLETSEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCDEVYPGIYIG 81
            |:..|...:....:..|..::|..:||.:|:           .||...:.|   .|||:|.:::|
 Frog     3 GETVSSSTHSGNEQSLTDIESTVGELQTLLN-----------SRRTSFSNH---VDEVWPNLFLG 53

  Fly    82 DAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHS-YYRDMPSIRRSHKDCVFRYMGFPMVDAP 145
            |.|.|.|:..|..|||||:||||.|.|:.:   |:| :|           .....|.|.|..|.|
 Frog    54 DLATANNRYELWKMGITHILNAAHGNRFCE---GNSDFY-----------SASIAYHGVPAYDVP 104

  Fly   146 TTDISRYFYVASKFIDSAI-SSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRD 209
            ..|:|:||..||.||..|: :||.::||||:||:|||||.|||||||..:|:...||:.|:..|.
 Frog   105 DFDMSKYFNSASAFIHQALNTSGARLLVHCVVGISRSATLVLAYLMIYHQMTLTQAIQRVQENRW 169

  Fly   210 IRPNDGFLQQLADLDMEL 227
            :.||.|||:||..||.||
 Frog   170 VSPNPGFLRQLLKLDGEL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 72/157 (46%)
dusp13XP_002937175.1 DUSP13A 43..187 CDD:350428 72/157 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6160
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I4544
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0000750
OrthoInspector 1 1.000 - - otm48358
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.