DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp8b

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_002665347.3 Gene:dusp8b / 100330259 ZFINID:ZDB-GENE-120914-3 Length:499 Species:Danio rerio


Alignment Length:186 Identity:58/186 - (31%)
Similarity:89/186 - (47%) Gaps:22/186 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PSRALP-GLRRAECAIHDVDCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTG 115
            |:..|| .|.:....:.::....:.|.:|:|......||..:...|||:||||:..|        
Zfish    40 PASILPLSLSQPCLPVANIGPTRILPHLYLGSQRDVLNKEVMSQNGITYVLNASNTC-------- 96

  Fly   116 HSYYRDMPS-IRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMS 179
                 ..|. |..:|      :|..|:.|:....:..:....::|||.|..|..:::||||.|:|
Zfish    97 -----PKPDFISENH------FMRIPVNDSYCEKLLPWLEKTNEFIDKAKVSNCRVIVHCLAGIS 150

  Fly   180 RSATCVLAYLMICRKMSAVDAIRTVRMRR-DIRPNDGFLQQLADLDMELKRKNLYP 234
            ||||..:||:|....:|:.||.|.|:.|| .|.||..||.||.:.:..|:.|...|
Zfish   151 RSATIAIAYIMKTMGLSSDDAYRFVKDRRPSISPNFNFLGQLLEFERGLEMKKSLP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 51/157 (32%)
dusp8bXP_002665347.3 RHOD <13..36 CDD:294087
DSPc 59..196 CDD:238073 51/155 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.