DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp29

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_012821347.1 Gene:dusp29 / 100124898 XenbaseID:XB-GENE-5944519 Length:238 Species:Xenopus tropicalis


Alignment Length:211 Identity:83/211 - (39%)
Similarity:115/211 - (54%) Gaps:29/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RYSPHYYQSPSRLETSEQTTGR-QLQRVLHYSMAPSRALPGLRRAECAIHDVDCDEVYPGIYIGD 82
            |..|:.|.|....:|...|.|. :|:| |.:..||..              ...:||:|.:||||
 Frog    37 RKKPNAYASVVDPDTGYCTPGAFELER-LFWHGAPKY--------------THVNEVWPNLYIGD 86

  Fly    83 AAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTT 147
            ...|.::..|...|.||:||||.| |: .||||..||.|:          ...|.|....|.|:.
 Frog    87 EKTALDRYSLEKNGFTHILNAAHG-RW-NVDTGPEYYSDI----------TVEYYGVEAEDLPSF 139

  Fly   148 DISRYFYVASKFIDSAISS-GGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDIR 211
            ::|::||.|::||.:|:|| ..|:||:|.:|.||||:.|||||||...|:.||:|..|...|.|.
 Frog   140 NLSQFFYPAAQFIRNALSSPSSKVLVNCAMGRSRSASLVLAYLMIYENMTVVDSIMQVLKHRCIL 204

  Fly   212 PNDGFLQQLADLDMEL 227
            ||.|||:||.:||::|
 Frog   205 PNRGFLKQLRELDIQL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 70/156 (45%)
dusp29XP_012821347.1 DSPc 74..217 CDD:238073 68/154 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6160
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I4544
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0000750
OrthoInspector 1 1.000 - - otm48358
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X520
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.