DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp16

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001090711.1 Gene:dusp16 / 100036691 XenbaseID:XB-GENE-1009863 Length:647 Species:Xenopus tropicalis


Alignment Length:190 Identity:56/190 - (29%)
Similarity:85/190 - (44%) Gaps:33/190 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SRALPGLRRAECA------------IHDVDCDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAE 105
            |...|||...:.:            :..|....:.|.:|:|......||..::...|.:||||:.
 Frog   131 SACFPGLCEGKASMVPTCISQPCLPVSSVGPTRILPHLYLGCQRDVLNKELMQQNEIGYVLNASN 195

  Fly   106 GCRYGQVDTGHSYYRDMPS-IRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGK 169
            .|             ..|. |..||      ::..|:.|:....|..:...:..||:.|.:|..:
 Frog   196 TC-------------PKPDFISDSH------FLRIPVNDSFCEKILPWLDKSVDFIEKAKASNDR 241

  Fly   170 ILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRR-DIRPNDGFLQQLADLDMELK 228
            :|||||.|:|||||..:||:|....||..:|.|.|:.:| .|.||..||.||.|.:.::|
 Frog   242 VLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQLLDFEKKIK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 50/157 (32%)
dusp16NP_001090711.1 DSP_MapKP 10..138 CDD:238723 3/6 (50%)
DSP_DUSP16 159..303 CDD:350494 52/162 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.