Sequence 1: | NP_001285421.1 | Gene: | CG7378 / 32888 | FlyBaseID: | FBgn0030976 | Length: | 235 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001345798.1 | Gene: | si:dkey-175m17.7 / 100007304 | ZFINID: | ZDB-GENE-091204-18 | Length: | 904 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 59/198 - (29%) |
---|---|---|---|
Similarity: | 91/198 - (45%) | Gaps: | 27/198 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 EQTTGRQLQRVLHYSMAPSRALPGLRRAECAI-HDVD---CDEVYPGIYIGDAAAAKNKTYLRLM 95
Fly 96 GITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFI 160
Fly 161 DSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDI-RPNDGFLQQLADLD 224
Fly 225 MEL 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7378 | NP_001285421.1 | DUSP3-like | 71..227 | CDD:350365 | 48/156 (31%) |
si:dkey-175m17.7 | XP_001345798.1 | SARG | 107..>311 | CDD:317751 | |
DSPc | 744..881 | CDD:238073 | 48/153 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1576308at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |