DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and si:dkey-175m17.7

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_001345798.1 Gene:si:dkey-175m17.7 / 100007304 ZFINID:ZDB-GENE-091204-18 Length:904 Species:Danio rerio


Alignment Length:198 Identity:59/198 - (29%)
Similarity:91/198 - (45%) Gaps:27/198 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EQTTGRQLQRVLHYSMAPSRALPGLRRAECAI-HDVD---CDEVYPGIYIGDAAAAKNKTYLRLM 95
            ::..||     :|.|:..|.:||.....|..: .||:   ...:.|.:::|:...|::...|..:
Zfish   709 DEENGR-----VHLSLPLSSSLPASLSDESVMTPDVENAVISPILPFLFLGNERDAQDLDLLLHL 768

  Fly    96 GITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFI 160
            .|..|:|.........:|||                 :.||...|..|....::.:||....:||
Zfish   769 NIGFVVNVTTHLPLYHLDTG-----------------LVRYKRLPATDNSKQNLRQYFEEVFEFI 816

  Fly   161 DSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDI-RPNDGFLQQLADLD 224
            :.|...|..:||||..|:|||||.|:||||....|:..||.:.||.||.| .||..|:.||.:.:
Zfish   817 EEAHQCGRGVLVHCQAGVSRSATIVIAYLMKHTLMTMTDAYKYVRGRRPIVSPNLNFMGQLLEFE 881

  Fly   225 MEL 227
            .:|
Zfish   882 RDL 884

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 48/156 (31%)
si:dkey-175m17.7XP_001345798.1 SARG 107..>311 CDD:317751
DSPc 744..881 CDD:238073 48/153 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.