DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and si:ch211-223p8.8

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001139098.1 Gene:si:ch211-223p8.8 / 100004731 ZFINID:ZDB-GENE-090313-91 Length:186 Species:Danio rerio


Alignment Length:201 Identity:85/201 - (42%)
Similarity:110/201 - (54%) Gaps:30/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QTTGRQLQRVLHYSMAPSRALPGLRRAECAIH--DVDC---DEVYPGIYIGDAAAAKNKTYLRLM 95
            :.|.:.|..|||.|       |.:...|..:|  .:.|   |||:|.:::||...:.::..|..:
Zfish     2 EDTDQILDNVLHKS-------PTIEELEGILHGGQLSCNHVDEVWPNLFLGDMYMSHDRYGLWSL 59

  Fly    96 GITHVLNAAEG--CRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASK 158
            |:|||||||.|  |..|..|    ||           ....:|.|.|..|.||.|||.:||.:::
Zfish    60 GVTHVLNAAHGKMCCKGNDD----YY-----------GTTVKYYGVPANDLPTFDISPFFYPSAQ 109

  Fly   159 FIDSAIS-SGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPNDGFLQQLAD 222
            :|..|:| :|.|:.|||.|||||||..|||||||....|.||||..|:.||.|.||.|||:||..
Zfish   110 YIHDALSTTGAKVFVHCAVGMSRSAALVLAYLMIYCNFSLVDAILKVKERRWIFPNRGFLKQLIT 174

  Fly   223 LDMELK 228
            ||.|||
Zfish   175 LDNELK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 73/161 (45%)
si:ch211-223p8.8NP_001139098.1 DSPc 34..176 CDD:238073 70/156 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0000750
OrthoInspector 1 1.000 - - otm25024
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.