DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp22b

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001017742.2 Gene:dusp22b / 100002272 ZFINID:ZDB-GENE-050417-257 Length:183 Species:Danio rerio


Alignment Length:152 Identity:44/152 - (28%)
Similarity:73/152 - (48%) Gaps:21/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRY 136
            ::|.|.:|:|:...|:::..|....|||:|:..        ||.....::|            .|
Zfish     6 NKVLPDLYLGNFKDARDREQLARNNITHILSIH--------DTAAPILQEM------------TY 50

  Fly   137 MGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAI 201
            :.....|:||.::.::|..:..||..:...|...|||||.|:|||.|.|:||:|....:...:|:
Zfish    51 LCIAAADSPTQNLIQHFRQSIAFIHQSRLKGEGCLVHCLAGVSRSVTLVVAYIMTVTTLGWQEAL 115

  Fly   202 RTVRMRRD-IRPNDGFLQQLAD 222
            ..|::.|. ..||.||..||.:
Zfish   116 AAVKIARPCASPNTGFQNQLQE 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 44/152 (29%)
dusp22bNP_001017742.2 DSPc 4..139 CDD:238073 44/152 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.