DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and dusp3a

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_001340818.2 Gene:dusp3a / 100000665 ZFINID:ZDB-GENE-111207-3 Length:200 Species:Danio rerio


Alignment Length:217 Identity:77/217 - (35%)
Similarity:112/217 - (51%) Gaps:35/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HYYQSPSRLE---TSEQTTGRQLQRVL-----HYSMAPSRALPGLRRAECAIHDVDCDEVYPGIY 79
            |:..:.:.||   |..:.|.:||.::|     .||: |::..               :||:|.||
Zfish     4 HHSPAKAPLEVTVTDTEATVQQLNKLLSDGSGFYSL-PAQHF---------------NEVFPRIY 52

  Fly    80 IGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDA 144
            ||:|..|:|...|:.:|:||:||.|||..:..|:|...:|....          ..|.|....|.
Zfish    53 IGNAFVAQNVMRLQRLGVTHILNVAEGNSFMHVNTNAEFYAGTG----------ITYHGIQANDT 107

  Fly   145 PTTDISRYFYVASKFIDSAISSG-GKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRR 208
            ...:||.:|..|:.|||.|::.| ||:.|||..|.|||.|.|:||||:..||....|..|||.:|
Zfish   108 EQFNISAFFEEAADFIDKALAHGKGKVYVHCREGYSRSPTIVIAYLMLRHKMDVRVATATVRHKR 172

  Fly   209 DIRPNDGFLQQLADLDMELKRK 230
            :|.||.|||.||..|:.:|.::
Zfish   173 EIGPNGGFLCQLCQLNEKLAKE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 65/156 (42%)
dusp3aXP_001340818.2 DSPc 45..188 CDD:238073 64/152 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45754
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.