DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhBL and SDH2

DIOPT Version :9

Sequence 1:NP_001285420.1 Gene:SdhBL / 32887 FlyBaseID:FBgn0030975 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_013059.1 Gene:SDH2 / 850685 SGDID:S000003964 Length:266 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:157/235 - (66%)
Similarity:189/235 - (80%) Gaps:5/235 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 PRLKTFEIYRWKPGD---QPQTQTYEVDLEQCGAMVLDALIKIKNEMDPTLTFRRSCREGICGSC 246
            ||||||::|||.|.:   :|..|:|:|||..||.||||||:|||:|.|.||||||||||||||||
Yeast    31 PRLKTFKVYRWNPDEPSAKPHLQSYQVDLNDCGPMVLDALLKIKDEQDSTLTFRRSCREGICGSC 95

  Fly   247 AMNINGTNTLACVSSIDQNESKCCRIYPLPHLYVVRDLVPDMSQFYDQYRSIQPWLQRKDLKREA 311
            ||||.|.|||||:..|||||||..:||||||:::|:|||||::.||.||:||||:|||....:: 
Yeast    96 AMNIGGRNTLACICKIDQNESKQLKIYPLPHMFIVKDLVPDLTNFYQQYKSIQPYLQRSSFPKD- 159

  Fly   312 GTAQYLQSVDDRLVLDGLYECILCACCQTSCPSYWWNSNKYLGPAVLMQAYRWVIDSRDEATEQR 376
            || :.|||::||..|||||||||||||.|||||||||..:|||||||||||||:|||||:||:.|
Yeast   160 GT-EVLQSIEDRKKLDGLYECILCACCSTSCPSYWWNQEQYLGPAVLMQAYRWLIDSRDQATKTR 223

  Fly   377 LDFLKDPWKLYRCHSIMNCTNTCPKHLNPARAIIQLKQLL 416
            ...|.:...|||||:|||||.||||.|||..||.::|:.|
Yeast   224 KAMLNNSMSLYRCHTIMNCTRTCPKGLNPGLAIAEIKKSL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhBLNP_001285420.1 sdhB 189..417 CDD:235652 153/231 (66%)
Fer2_3 189..293 CDD:289830 71/106 (67%)
Fer4_8 330..403 CDD:289926 54/72 (75%)
SDH2NP_013059.1 PLN00129 31..264 CDD:215067 157/235 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343850
Domainoid 1 1.000 137 1.000 Domainoid score I1066
eggNOG 1 0.900 - - E1_COG0479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 376 1.000 Inparanoid score I346
Isobase 1 0.950 - 0 Normalized mean entropy S140
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46869
orthoMCL 1 0.900 - - OOG6_100664
Panther 1 1.100 - - O PTHR11921
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1851
TreeFam 1 0.960 - -
1110.700

Return to query results.
Submit another query.