DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhBL and SDH2-1

DIOPT Version :9

Sequence 1:NP_001285420.1 Gene:SdhBL / 32887 FlyBaseID:FBgn0030975 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001118718.1 Gene:SDH2-1 / 822359 AraportID:AT3G27380 Length:279 Species:Arabidopsis thaliana


Alignment Length:288 Identity:153/288 - (53%)
Similarity:191/288 - (66%) Gaps:29/288 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 KPGGAAAAA----AGSAKPGGASTGKPASGNAPATPPPPPPPPPAKSAPPVKAKKPRLKTFEIYR 194
            ||...|.||    |.....|..:..|.:||.                     .:...||||:|||
plant    13 KPSKLATAARLIPARWTSTGAEAETKASSGG---------------------GRGSNLKTFQIYR 56

  Fly   195 WKPGD--QPQTQTYEVDLEQCGAMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGTNTLA 257
            |.|.:  :|:.|.|::||:.||.|||||||||||||||:|||||||||||||||||||:|.|.||
plant    57 WNPDNPGKPELQNYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA 121

  Fly   258 CVSSIDQNESKCCRIYPLPHLYVVRDLVPDMSQFYDQYRSIQPWLQRKDLKREAGTAQYLQSVDD 322
            |::.| |:|:....|.||||::|::|||.||:.||:||:||:|||:|| ........:.|||..|
plant   122 CLTKI-QDEASETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK-TPASVPAKEILQSKKD 184

  Fly   323 RLVLDGLYECILCACCQTSCPSYWWNSNKYLGPAVLMQAYRWVIDSRDEATEQRLDFLKDPWKLY 387
            |..|||:|||||||||.|||||||||...|||||.|:.|.||:.|||||.|::||:.:.|.:|||
plant   185 RAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEAIDDEFKLY 249

  Fly   388 RCHSIMNCTNTCPKHLNPARAIIQLKQL 415
            |||:|:||...|||.|||.:.|..:|||
plant   250 RCHTILNCARACPKGLNPGKQITHIKQL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhBLNP_001285420.1 sdhB 189..417 CDD:235652 141/229 (62%)
Fer2_3 189..293 CDD:289830 68/105 (65%)
Fer4_8 330..403 CDD:289926 48/72 (67%)
SDH2-1NP_001118718.1 PLN00129 1..279 CDD:215067 153/288 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 165 1.000 Domainoid score I1211
eggNOG 1 0.900 - - E1_COG0479
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 346 1.000 Inparanoid score I627
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264157at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm957
orthoMCL 1 0.900 - - OOG6_100664
Panther 1 1.100 - - O PTHR11921
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1851
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.