DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhBL and Sdhb

DIOPT Version :9

Sequence 1:NP_001285420.1 Gene:SdhBL / 32887 FlyBaseID:FBgn0030975 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_075863.2 Gene:Sdhb / 67680 MGIID:1914930 Length:282 Species:Mus musculus


Alignment Length:251 Identity:169/251 - (67%)
Similarity:204/251 - (81%) Gaps:4/251 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 KSAPPVKAKKPRLKTFEIYRWKP---GDQPQTQTYEVDLEQCGAMVLDALIKIKNEMDPTLTFRR 236
            :.|....|..||:|.|.||||.|   ||:|:.|||||||.:||.||||||||||||:|.||||||
Mouse    29 RGAQTAAAAAPRIKKFAIYRWDPDKTGDKPRMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRR 93

  Fly   237 SCREGICGSCAMNINGTNTLACVSSIDQNESKCCRIYPLPHLYVVRDLVPDMSQFYDQYRSIQPW 301
            ||||||||||||||||.|||||...||.:.||..:||||||:||::|||||:|.||.||:||:|:
Mouse    94 SCREGICGSCAMNINGGNTLACTRRIDTDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPY 158

  Fly   302 LQRKDLKREAGTAQYLQSVDDRLVLDGLYECILCACCQTSCPSYWWNSNKYLGPAVLMQAYRWVI 366
            |::||..:| |..|||||::||..|||||||||||||.|||||||||.:||||||||||||||:|
Mouse   159 LKKKDESQE-GKQQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMI 222

  Fly   367 DSRDEATEQRLDFLKDPWKLYRCHSIMNCTNTCPKHLNPARAIIQLKQLLVGLKKK 422
            ||||:.||:||..|:||:.:||||:|||||.||||.|||.:||.::|:::...|:|
Mouse   223 DSRDDFTEERLAKLQDPFSVYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhBLNP_001285420.1 sdhB 189..417 CDD:235652 162/230 (70%)
Fer2_3 189..293 CDD:289830 77/106 (73%)
Fer4_8 330..403 CDD:289926 57/72 (79%)
SdhbNP_075863.2 sdhB 43..274 CDD:235652 162/231 (70%)
Fer2_3 43..149 CDD:289830 76/105 (72%)
Interaction with SDHAF1. /evidence=ECO:0000250|UniProtKB:P21912 148..220 53/72 (74%)
Fer4_17 187..260 CDD:290268 56/72 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837196
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S140
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100664
Panther 1 1.100 - - O PTHR11921
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1851
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.650

Return to query results.
Submit another query.