DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhBL and sdhb

DIOPT Version :9

Sequence 1:NP_001285420.1 Gene:SdhBL / 32887 FlyBaseID:FBgn0030975 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001092210.1 Gene:sdhb / 562149 ZFINID:ZDB-GENE-030131-8005 Length:280 Species:Danio rerio


Alignment Length:250 Identity:175/250 - (70%)
Similarity:209/250 - (83%) Gaps:7/250 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 SAPPVKAKKPRLKTFEIYRWKP---GDQPQTQTYEVDLEQCGAMVLDALIKIKNEMDPTLTFRRS 237
            :||   |.:||:|.|:||||.|   ||:|:.||||:||..||.||||||||||||||.|||||||
Zfish    30 AAP---AAQPRIKKFQIYRWDPDTVGDKPRMQTYEIDLNTCGPMVLDALIKIKNEMDSTLTFRRS 91

  Fly   238 CREGICGSCAMNINGTNTLACVSSIDQNESKCCRIYPLPHLYVVRDLVPDMSQFYDQYRSIQPWL 302
            |||||||||||||||.|||||::.||.|.||..:||||||:|||:|||||||.||.||:||:|:|
Zfish    92 CREGICGSCAMNINGGNTLACLNKIDTNTSKVTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYL 156

  Fly   303 QRKDLKREAGTAQYLQSVDDRLVLDGLYECILCACCQTSCPSYWWNSNKYLGPAVLMQAYRWVID 367
            ::|| :.:.|..||||||:||..|||||||||||||.|||||||||::||||||||||||||:||
Zfish   157 KKKD-ESQQGKQQYLQSVEDRQKLDGLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWMID 220

  Fly   368 SRDEATEQRLDFLKDPWKLYRCHSIMNCTNTCPKHLNPARAIIQLKQLLVGLKKK 422
            |||:.||.||..|:||:.|||||:|||||.||||.|||.:||.::|:::|..|:|
Zfish   221 SRDDFTEDRLSKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMVTYKQK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhBLNP_001285420.1 sdhB 189..417 CDD:235652 166/230 (72%)
Fer2_3 189..293 CDD:289830 80/106 (75%)
Fer4_8 330..403 CDD:289926 58/72 (81%)
sdhbNP_001092210.1 sdhB 40..271 CDD:235652 166/231 (72%)
Fer2_3 40..146 CDD:289830 79/105 (75%)
Fer4_17 184..257 CDD:290268 57/72 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580783
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264157at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100664
Panther 1 1.100 - - O PTHR11921
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1851
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.