DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhBL and SdhB

DIOPT Version :9

Sequence 1:NP_001285420.1 Gene:SdhBL / 32887 FlyBaseID:FBgn0030975 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_477101.1 Gene:SdhB / 35590 FlyBaseID:FBgn0014028 Length:297 Species:Drosophila melanogaster


Alignment Length:262 Identity:187/262 - (71%)
Similarity:219/262 - (83%) Gaps:4/262 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 KSAPPVKAKKPRLKTFEIYRWKP---GDQPQTQTYEVDLEQCGAMVLDALIKIKNEMDPTLTFRR 236
            :.|.|.:|::|::|.||||||.|   |::|..|||||||.:||.|||||||||||||||||||||
  Fly    34 QQAQPKEAQEPQIKKFEIYRWNPDNAGEKPYMQTYEVDLRECGPMVLDALIKIKNEMDPTLTFRR 98

  Fly   237 SCREGICGSCAMNINGTNTLACVSSIDQNESKCCRIYPLPHLYVVRDLVPDMSQFYDQYRSIQPW 301
            ||||||||||||||.|||||||:|.||.|.||..::|||||:||||||||||:.||:|||:||||
  Fly    99 SCREGICGSCAMNIGGTNTLACISKIDINTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPW 163

  Fly   302 LQRK-DLKREAGTAQYLQSVDDRLVLDGLYECILCACCQTSCPSYWWNSNKYLGPAVLMQAYRWV 365
            |||| :...:.|.|||||||:||..|||||||||||||.|||||||||:.||||||||||||||:
  Fly   164 LQRKNEAGEKKGKAQYLQSVEDRSKLDGLYECILCACCSTSCPSYWWNAEKYLGPAVLMQAYRWI 228

  Fly   366 IDSRDEATEQRLDFLKDPWKLYRCHSIMNCTNTCPKHLNPARAIIQLKQLLVGLKKKGKPQLKTD 430
            ||||||.:.:||:.||||:.:||||:|||||.||||.|||.|||.::|:||.||..|..|:|:|.
  Fly   229 IDSRDENSAERLNKLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLASKPAPKLETA 293

  Fly   431 AL 432
            ||
  Fly   294 AL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhBLNP_001285420.1 sdhB 189..417 CDD:235652 173/231 (75%)
Fer2_3 189..293 CDD:289830 82/106 (77%)
Fer4_8 330..403 CDD:289926 57/72 (79%)
SdhBNP_477101.1 PLN00129 6..279 CDD:215067 177/244 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449286
Domainoid 1 1.000 165 1.000 Domainoid score I1211
eggNOG 1 0.900 - - E1_COG0479
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 346 1.000 Inparanoid score I627
Isobase 1 0.950 - 0 Normalized mean entropy S140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264157at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51439
orthoMCL 1 0.900 - - OOG6_100664
Panther 1 1.100 - - P PTHR11921
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1851
1110.750

Return to query results.
Submit another query.