DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhBL and Sdhb

DIOPT Version :9

Sequence 1:NP_001285420.1 Gene:SdhBL / 32887 FlyBaseID:FBgn0030975 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001094009.1 Gene:Sdhb / 298596 RGDID:1308598 Length:282 Species:Rattus norvegicus


Alignment Length:251 Identity:170/251 - (67%)
Similarity:204/251 - (81%) Gaps:4/251 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 KSAPPVKAKKPRLKTFEIYRWKP---GDQPQTQTYEVDLEQCGAMVLDALIKIKNEMDPTLTFRR 236
            :.|....|..||:|||.||||.|   ||:|:.|||:|||.:||.||||||||||||:|.||||||
  Rat    29 REAQTAAAAAPRIKTFAIYRWDPDKAGDKPRMQTYKVDLNKCGPMVLDALIKIKNEIDSTLTFRR 93

  Fly   237 SCREGICGSCAMNINGTNTLACVSSIDQNESKCCRIYPLPHLYVVRDLVPDMSQFYDQYRSIQPW 301
            ||||||||||||||||.|||||...||.:..|..:||||||:||::|||||:|.||.||:||:|:
  Rat    94 SCREGICGSCAMNINGGNTLACTRRIDTDLGKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPY 158

  Fly   302 LQRKDLKREAGTAQYLQSVDDRLVLDGLYECILCACCQTSCPSYWWNSNKYLGPAVLMQAYRWVI 366
            |::||..:| |..|||||::||..|||||||||||||.|||||||||.:||||||||||||||:|
  Rat   159 LKKKDESQE-GKQQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMI 222

  Fly   367 DSRDEATEQRLDFLKDPWKLYRCHSIMNCTNTCPKHLNPARAIIQLKQLLVGLKKK 422
            |||||.||:||..|:||:.|||||:|||||.||||.|||.:||.::|:::...|:|
  Rat   223 DSRDEFTEERLAKLQDPFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhBLNP_001285420.1 sdhB 189..417 CDD:235652 163/230 (71%)
Fer2_3 189..293 CDD:289830 76/106 (72%)
Fer4_8 330..403 CDD:289926 59/72 (82%)
SdhbNP_001094009.1 PLN00129 29..273 CDD:215067 168/244 (69%)
Interaction with SDHAF1. /evidence=ECO:0000250|UniProtKB:P21912 148..220 53/72 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340914
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264157at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100664
Panther 1 1.100 - - O PTHR11921
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1851
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.710

Return to query results.
Submit another query.