DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhBL and F42A8.1

DIOPT Version :9

Sequence 1:NP_001285420.1 Gene:SdhBL / 32887 FlyBaseID:FBgn0030975 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_495991.1 Gene:F42A8.1 / 174481 WormBaseID:WBGene00009626 Length:370 Species:Caenorhabditis elegans


Alignment Length:160 Identity:28/160 - (17%)
Similarity:40/160 - (25%) Gaps:77/160 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 WKPGDQPQTQTYEVDLEQCGAMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGTNTLACV 259
            |:.|||.....|..:                            ||.|          ....|.|:
 Worm    46 WQEGDQVTRGKYFYE----------------------------CRRG----------QLEPLGCL 72

  Fly   260 SSIDQNESKCCRIYPLPHLYVVRDLVPDMSQFYDQ---------------------YRSIQPWLQ 303
            ||.::.       .||.|.:     ..|..:|..|                     |:..:.|..
 Worm    73 SSTEEK-------IPLGHTF-----QQDRYEFICQLGSDGYIEFGYSACVGTDGRTYQKGETWTD 125

  Fly   304 RKDLKREAGTAQYLQSVDDRLVLDGLYECI 333
            .|:      |..|....|.|:|...:..||
 Worm   126 AKN------TYYYRCRDDGRVVKTTIEGCI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhBLNP_001285420.1 sdhB 189..417 CDD:235652 28/160 (18%)
Fer2_3 189..293 CDD:289830 17/97 (18%)
Fer4_8 330..403 CDD:289926 2/4 (50%)
F42A8.1NP_495991.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.