DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Flacc and THOC2

DIOPT Version :9

Sequence 1:NP_573339.1 Gene:Flacc / 32886 FlyBaseID:FBgn0030974 Length:1150 Species:Drosophila melanogaster
Sequence 2:XP_016885151.1 Gene:THOC2 / 57187 HGNCID:19073 Length:1697 Species:Homo sapiens


Alignment Length:443 Identity:99/443 - (22%)
Similarity:171/443 - (38%) Gaps:78/443 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SSSDSTSDSDSGSSSYSSTD-----SEQGVGGVG-VGVGVPGGAGGPGGSGSVHGHPHTHGHGHH 82
            |||...|.|.|..||...||     |:.||..|. .....|.|....|.|||.............
Human  1281 SSSSIGSASKSDESSTEETDKSRERSQCGVKAVNKASSTTPKGNSSNGNSGSNSNKAVKENDKEK 1345

  Fly    83 PRSAERHHRKK-----KSSRRGGSSSGDEPSSSRRKRDKRDHVQKKLVAKRNHIKRKLKEARLKK 142
            .:..|:..::|     ..:|..|....::|...|..:|::....|:...|.:..|.|.|:....|
Human  1346 GKEKEKEKKEKTPATTPEARVLGKDGKEKPKEERPNKDEKARETKERTPKSDKEKEKFKKEEKAK 1410

  Fly   143 RAAAALSGHVHRSLSPTTRAKLKKLAERK----RLRAASKEQRERDKLR---------------- 187
                   ....::..|...:|..:..||:    |.|..:||.:.::.::                
Human  1411 -------DEKFKTTVPNAESKSTQEREREKEPSRERDIAKEMKSKENVKGGEKTPVSGSLKSPVP 1468

  Fly   188 ---VVQRDRERDHHRLGSSRSPPSSSTTTTTKIRIHQDIVGKRQKSPGLGSGLGGGSSSSSSRMH 249
               :.:.:||:...::.:..||..|||...    ::..:.....|.|     ||..:.:||..:.
Human  1469 RSDIPEPEREQKRRKIDTHPSPSHSSTVKL----VYFQVTAILPKVP-----LGSENYASSPVIS 1524

  Fly   250 -HQLM--------SREKIIIQTRARGRTPSLERERER---ERERERERERERHDLSLRERDRRDR 302
             |.|.        |..|:.|.......:.|.|||.::   ::.|||.||||:.|    |:||::|
Human  1525 IHFLQDSLIELKESSAKLYINHTPPPLSKSKEREMDKKDLDKSRERSREREKKD----EKDRKER 1585

  Fly   303 ERERA--EREAARD--KERAEALARCQERQRERERLAREKLRRQEEEEGGKRGGPGRDLDLPPYG 363
            :|:.:  :||...|  |.|.|........:.:.|.........::::|..|....|::.....:.
Human  1586 KRDHSNNDREVPPDLTKRRKEENGTMGVSKHKSESPCESPYPNEKDKEKNKSKSSGKEKGSDSFK 1650

  Fly   364 SRERSLDTVERERERERSGRHVRDKRELDPYEREQEY--LEERHGHGLIDEMR 414
            |.:  :|.:....::|  .||  ||.:::..|:....  .||:..|...|:.|
Human  1651 SEK--MDKISSGGKKE--SRH--DKEKIEKKEKRDSSGGKEEKKHHKSSDKHR 1697



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1874
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.