DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Flacc and Thoc2

DIOPT Version :9

Sequence 1:NP_573339.1 Gene:Flacc / 32886 FlyBaseID:FBgn0030974 Length:1150 Species:Drosophila melanogaster
Sequence 2:XP_006541566.1 Gene:Thoc2 / 331401 MGIID:2442413 Length:1621 Species:Mus musculus


Alignment Length:445 Identity:100/445 - (22%)
Similarity:173/445 - (38%) Gaps:79/445 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 THSSSSDSTSDSD-SGSSSYSSTDSEQGVGGVGVGVG---VPGGAGGPGGSGSVHGHPHTHGHGH 81
            |.|||..:.|.|| ||:.....:......|...|...   .|.|....|.|||............
Mouse  1208 TSSSSIGNASKSDESGAEETDKSRERSQCGTKAVNKASSTTPKGNSSNGNSGSNSNKAVKENDKE 1272

  Fly    82 HPRSAERHHRKK-----KSSRRGGSSSGDEPSSSRRKRDKRDHVQKKLVAKRNHIKRKLKEARLK 141
            ..:..|:..::|     ..:|..|..|.::|...|..::.:....|:...|.:..|.|.|:....
Mouse  1273 KVKEKEKEKKEKTPATTPEARALGKDSKEKPKEERPNKEDKARETKERTPKSDKEKEKFKKEEKA 1337

  Fly   142 KRAAAALSGHVHRSLSPTTRAKLKKLAERKRLRAASKEQRERDKLR------------------- 187
            |......:..:..|.|...|.:.|   |..|.|..:||.:.::.::                   
Mouse  1338 KDEKFKTTVPIVESKSTQEREREK---EPSRERDVAKEMKSKENVKGGEKTPVSGSLKSPVPRSD 1399

  Fly   188 VVQRDRERDHHRLGSSRSPPSSSTTTTTKIRIHQDIVGKRQKSPGLGSGLGGGSSSSSSRMH-HQ 251
            :.:.|||:...::.|..||..|||...|      ||:   .|.|     ||..:.:||..:. |.
Mouse  1400 ISEPDREQKRRKIDSHPSPSHSSTVKVT------DIL---PKVP-----LGSENYASSPVISIHF 1450

  Fly   252 LM--------SREKIIIQTRARGRTPSLERERER---ERERERERERERHDLSLRERDRRDRERE 305
            |.        |..|:.|.......:.|.|||.::   ::.|||.||||:.|    |:||::|:|:
Mouse  1451 LQDSLIDLKDSSAKLYINHNPPPLSKSKEREMDKKDLDKSRERSREREKKD----EKDRKERKRD 1511

  Fly   306 RA--EREAARD--KERAEALARCQERQRERERLAREKLRRQEEEEGGKRGGPGRDLDLPPYGSRE 366
            .:  :||...|  |.|.|........:.:.|.....:...::::|..|....|::         :
Mouse  1512 HSNNDREVPPDITKRRKEENGTMGVSKHKSESPCESQYPNEKDKEKNKSKSSGKE---------K 1567

  Fly   367 RSLDTVERER-ERERSGRHVRDKRELDPYEREQEYLEERHGHGLIDEMRRYRRRD 420
            .|.|:.:.|: ::..||.....:.:.:..|::    |:|...|..:|.:.::..|
Mouse  1568 SSSDSFKSEKMDKISSGGKKESRHDKEKIEKK----EKRDSSGGKEEKKHHKSSD 1618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FlaccNP_573339.1 None
Thoc2XP_006541566.1 THOC2_N 11..566 CDD:374385
Thoc2 568..642 CDD:371698
Tho2 874..1173 CDD:371438
SF-CC1 1475..>1532 CDD:273721 23/60 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1874
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.