DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Flacc and Thoc2l

DIOPT Version :9

Sequence 1:NP_573339.1 Gene:Flacc / 32886 FlyBaseID:FBgn0030974 Length:1150 Species:Drosophila melanogaster
Sequence 2:NP_001160053.1 Gene:Thoc2l / 100042165 MGIID:3040669 Length:1589 Species:Mus musculus


Alignment Length:568 Identity:108/568 - (19%)
Similarity:208/568 - (36%) Gaps:163/568 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 KRDKRDHVQKKLVAKRNHIKRKLKEARLKKRAAAALS----GHVHRSLSPTTR-----AKLKKLA 168
            |.|:.|:...:.|..:.|.|       |.|.:...|.    .|:...|...|:     .|:..|.
Mouse  1084 KADQLDYENFRHVVHKWHYK-------LTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLG 1141

  Fly   169 E--RKRLRAASKEQRERD--------------KLRVVQRDRERDHHRLGSSRSPPSSSTTTTTKI 217
            :  .:|:....:|::|:.              |.|......|.:.|.    :.||..:|.|..  
Mouse  1142 QALERRVHKICQEEKEKKPDLYALAMVYSGQLKSRKSYMIPENEFHH----KDPPPRNTATNL-- 1200

  Fly   218 RIHQDIVGKRQKSP--GLGSGLGGGSSSSSSRMHHQLMSREKIIIQTRARGRTPSLE-------- 272
                     :...|  ||.|.:|.......|.......|||:.....:|..:..|:.        
Mouse  1201 ---------QPSGPCSGLPSSIGSMCKLDESSAEEADKSRERAQCAVKAANKASSVTPKGNLSNG 1256

  Fly   273 ---------RERERERERERERERERHDLSLRERDR---RDRERERAEREAARDKERAEALARCQ 325
                     :|.::|:.:|:|:|::....::....|   :|.:.:..|.:..:|::..||..|..
Mouse  1257 NSGSNSKAVKENDKEKGKEKEKEKKEKTPAVTPEARVLGKDSKEKPKEEQPNKDEKIREAKERMP 1321

  Fly   326 ERQRERERLAREKLRRQEE-------------EEGGKRGGPGRDLDL----------------PP 361
            :..:::|:|.:|:..:.|:             :|..|...|.::.||                |.
Mouse  1322 KSDKDKEKLKKEEKAKDEKFRIIVANVESKSTQEREKEKEPSKERDLAKEMKSKENVKGGEKAPV 1386

  Fly   362 YGSRERSL---DTVERERERERSGRHVRDKRELDPYEREQEYLEERHGHGLIDEMRRYRRRDLSP 423
            .||.:..:   |..|.|||:         :|::|.:.      ...|...:.|.:.:.:......
Mouse  1387 SGSLKSPISRTDITEPEREK---------RRKVDSHP------SPSHSSTIKDSLVKLKESSAKL 1436

  Fly   424 MPEHYAP-------RLRDPRELYSEEERERAYKRAYLDAR--------YSSREREAWLEARELRE 473
            ...|..|       |..|.::|  ::.|||:.:|...:.:        ||:.:|||.|:..:.|:
Mouse  1437 YINHIPPLLCKSKEREADKKDL--DKSRERSREREKKEEKDRKERKRDYSNNDREAPLDLIKRRK 1499

  Fly   474 RE---LQGREYRDLETEDTLYPDERERLIRDRERDRERERDRERERNIGPRGD-FRPEWEREWEE 534
            .|   |...:::.....::|||:|     :|:|:.:.:...:|       :|| |:||   :.::
Mouse  1500 DENGILGVSKHKSESPCESLYPNE-----KDKEKMKSKSSGKE-------KGDSFKPE---KIDK 1549

  Fly   535 EGAGGGPGGPSGTPGRPGGFVGGPKRGKPPAHAGGGPPSQQQHHSASE 582
            ..:|....|..           ..|..|.....|.|...:::||..|:
Mouse  1550 ISSGKKESGHD-----------KEKIEKKEKWDGSGDKEEKKHHKTSD 1586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FlaccNP_573339.1 None
Thoc2lNP_001160053.1 THOC2_N 13..566 CDD:406523
Thoc2 568..642 CDD:403051
Tho2 874..1173 CDD:402722 17/95 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1874
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.