DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7332 and MINDY4

DIOPT Version :9

Sequence 1:NP_001285417.1 Gene:CG7332 / 32885 FlyBaseID:FBgn0030973 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_115598.2 Gene:MINDY4 / 84182 HGNCID:21916 Length:757 Species:Homo sapiens


Alignment Length:512 Identity:128/512 - (25%)
Similarity:198/512 - (38%) Gaps:177/512 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PASSSSQQEKQPMLNATDMRELREIKQLLWGDNVREDVF----KRWS-QGFEFSKVE--PSALVQ 133
            |:....|...:|:    |:...:|||.||:|.:     |    :.|. |.|.||...  ...:||
Human   395 PSVLKLQTASKPI----DLSVAKEIKTLLFGSS-----FCCFNEEWKLQSFSFSNTASLKYGIVQ 450

  Fly   134 KQGGPCAVIAPVQAYLLKIIIMDLPGIKLSEISLDKSQNL----------LIQALCDILKNCRAP 188
            .:||||.|:|.||..:|:.::.:      .:...|.:|.|          |:.||.||:..... 
Human   451 NKGGPCGVLAAVQGCVLQKLLFE------GDSKADCAQGLQPSDAHRTRCLVLALADIVWRAGG- 508

  Fly   189 RYRIVHLLRRRGNATEAGSTKKRSPAGEEESALAGQAAGSSEEVEEAAEATPASVSKLSQALQ-L 252
                    |.|.....|..|::.||.|:.      :|.|..|.:      |..|::.....:. |
Human   509 --------RERAVVALASRTQQFSPTGKY------KADGVLETL------TLHSLTCYEDLVTFL 553

  Fly   253 EHDMHQ-ELSPDEFHERLHTLHFKNIAAVARYYMENYDQLAHTYGVLLFMYSVFLTKGLELVAAD 316
            :..:|| |:.|                                ||.:|...|..|::..||:..|
Human   554 QQSIHQFEVGP--------------------------------YGCILLTLSAILSRSTELIRQD 586

  Fly   317 ISDTSEPLIHSTYGYGGQSLINLMLTGRAVAHVWDN--EQDVGG---LKLRGICEQSDIGFITLM 376
            ....:..|| ..:||..|.|:||:|||:||::|:::  |.|.|.   ..||||..:|||||::|.
Human   587 FDVPTSHLI-GAHGYCTQELVNLLLTGKAVSNVFNDVVELDSGDGNITLLRGIAARSDIGFLSLF 650

  Fly   377 EEMRYCTVGSFFKNPRYPVWVMGSDTHLTVLFSNEKRLVSPETPSETGRRIFKSYDPEGNNFIST 441
            |....|.||.|.|.||:|:||:.|::|.::|||                                
Human   651 EHYNMCQVGCFLKTPRFPIWVVCSESHFSILFS-------------------------------- 683

  Fly   442 TMLREVLIALNLVSEPAYVALMQKRLDPENLGIILLNAFMDEFFPLESRSTPDTFELMHYNGIPG 506
                                     |.|   |:            |....|...|:|.:|:|:  
Human   684 -------------------------LQP---GL------------LRDWRTERLFDLYYYDGL-- 706

  Fly   507 SNENNKVRYYCGTAILLEGDLKSVCTSN----PMVTCLQTKWPNIEINWHDGHMPSL 559
            :|:..::|....|...:..|     |.|    |:..|::|||....:|| :|..|.|
Human   707 ANQQEQIRLTIDTTQTISED-----TDNDLVPPLELCIRTKWKGASVNW-NGSDPIL 757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7332NP_001285417.1 DUF4205 101..>416 CDD:290609 97/338 (29%)
MINDY4NP_115598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..173
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..334
DUF4205 416..752 CDD:290609 119/480 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2871
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1276386at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.