DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7326 and IPA1

DIOPT Version :9

Sequence 1:NP_001259695.1 Gene:CG7326 / 32882 FlyBaseID:FBgn0030970 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_012675.1 Gene:IPA1 / 853606 SGDID:S000003902 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:47/229 - (20%)
Similarity:92/229 - (40%) Gaps:63/229 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IELRPNLRSGVVFLRFDQQVSQSQKTRVVVRDYNVYISEKPKNQAIDLDSSSESDSEDSDKLMLI 72
            :|:: ||:..::.:..|::..:.....|.|.: .|..|.|.||:..||:..::..|: |.|:   
Yeast    25 VEIK-NLKDTLMSISGDEEQVEDILLPVEVEE-KVDASYKFKNRGKDLEWMTKLRSK-SSKI--- 83

  Fly    73 RHAQYGMDIVCLSTFLVSGRNISFRFNYNQIDLASVDGSAVDVPLAPLLLSCQENEPITINCRDC 137
                |...|:.|.    .||       :.:.:|.|                   :...:|.|.:|
Yeast    84 ----YDSSIMSLP----DGR-------WTKEELRS-------------------DSDFSIECLNC 114

  Fly   138 RAELVAGRSYRRLREFPSLLVDPTEF------FCHNHGPAGK------TQPISLVPAETDLFYGL 190
            :.::::..:.:.|.:.||      ||      :.|.|.|..|      |:..:|.|::.::..|.
Yeast   115 KQKIISKDNCQVLNDMPS------EFWFELMDYWHCHKPDVKEDKSSYTRFETLKPSKNEILIGS 173

  Fly   191 NY---VVINFNEESSCMLNRDDHLYCQRCMRYLG 221
            :|   ....|  |:......:|::.|.:|...||
Yeast   174 SYFQGTPATF--ENVATTKENDNVLCIKCSAVLG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7326NP_001259695.1 HECT_2 9..381 CDD:286852 47/228 (21%)
IPA1NP_012675.1 COG5629 4..347 CDD:227916 47/229 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4784
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.