DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7326 and Ube2cbp

DIOPT Version :9

Sequence 1:NP_001259695.1 Gene:CG7326 / 32882 FlyBaseID:FBgn0030970 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_081670.1 Gene:Ube2cbp / 70348 MGIID:1917598 Length:368 Species:Mus musculus


Alignment Length:316 Identity:68/316 - (21%)
Similarity:117/316 - (37%) Gaps:60/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VSGRNISFRFNYNQIDLASVDGSAVDVPLAPLLLSCQENEPITINCRDCRAELVAGRSYRRLREF 153
            :||..:..|..        |...:...|::....|.|..|..|..|:.|....:..|...|:...
Mouse    74 ISGDGLHLRLR--------VQAESSPQPISVFNQSLQAQECCTFYCQSCGEVTIKDRKLLRVLPL 130

  Fly   154 P----SLLVDPTEFFCHNHGPAGKTQPISLVPAETDLFYGLNYVVINFNEESSCMLNRDDHLYCQ 214
            |    |.||.  |:.||....|.:    .|.|.|.|.|.|.::.::|...:.......:..:.|:
Mouse   131 PSENWSALVG--EWCCHPDPFANR----PLHPRENDCFIGDSFFLVNLKSDLEQEPKANTKVICK 189

  Fly   215 RCMRYLGLTMFDGAAARIWADAVRWRPA-GAATNAPDRHFFQNSTLTQLFKRLLHSLWPQPLPQL 278
            ||...||.|| .....:.:...|..||: |:..|.|...|.|             |:..|.|.: 
Mouse   190 RCKVTLGETM-SSETTKFYMTEVIIRPSEGSFPNIPRSQFLQ-------------SIIAQCLVE- 239

  Fly   279 CLNTSRAVLVTSLPNRN-QQYMFLHVVESQLRVLRRIRPNSNRLRCFR----------------- 325
             |:::|:....::..:: :.|:.|.|:.|...|:..:|.:|    |.|                 
Mouse   240 -LSSARSTFRFTIQGQDGKVYILLWVLNSDSLVIEPLRSSS----CSRKFPLLESSLEAGSGSAW 299

  Fly   326 -ACKLYYG--VFGANPPLLEKWQAQQTLPQMDVSPNMFLKIQKRLETNGHLIPDAL 378
             |.|:.|.  :...|..|...|:...::..:.:.....|::...|..|...:|.:|
Mouse   300 NAIKVLYQPCIKSRNKELASSWEGDISVHPLTLPSATCLELLLILSRNNASLPLSL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7326NP_001259695.1 HECT_2 9..381 CDD:286852 68/316 (22%)
Ube2cbpNP_081670.1 HECT_2 13..358 CDD:286852 68/316 (22%)
Interaction with UBE2C. /evidence=ECO:0000250 214..236 8/34 (24%)
HECT-like. /evidence=ECO:0000250 332..368 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4784
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.