DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7326 and ube3d

DIOPT Version :9

Sequence 1:NP_001259695.1 Gene:CG7326 / 32882 FlyBaseID:FBgn0030970 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001313339.1 Gene:ube3d / 553294 ZFINID:ZDB-GENE-091218-3 Length:388 Species:Danio rerio


Alignment Length:245 Identity:56/245 - (22%)
Similarity:87/245 - (35%) Gaps:80/245 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCIELRPNLRSGVVFLRFDQQVSQSQKTRVVVRDYNVYISEKPKNQAIDLDSSSESDSEDSDKLM 70
            |.||||..|:||::|:|.|          |:....:|.|..||       ||.....:.||.   
Zfish    10 LFIELRQKLQSGLLFIRSD----------VIGGGADVKIESKP-------DSILNVQTPDSS--- 54

  Fly    71 LIRHAQYGMDIVCLSTFLVSGRNISFRFNYNQIDLA-SVDGS------AVDVPL---APLLLSCQ 125
                         ....|..|  :|......|...| |..||      .|:.|.   ..::...:
Zfish    55 -------------FQVTLTPG--VSLVETQKQKSPANSEQGSHYRLRLKVEQPTESPCSVIGQLR 104

  Fly   126 ENEPITINCRDCRAELVAGRSYRRLREFP----SLLVDPTEFFCHNHGPAGKTQPISLVPAETDL 186
            .:|..::.|:.|.:.::..||:.|:...|    :.|||  ::.||....|.:    .|:|...|.
Zfish   105 VDESYSVLCQSCGSRVLQHRSFGRVLPLPNGNWNALVD--DWCCHPDPFANR----KLLPRAGDC 163

  Fly   187 FYGLNYVVINFNEESSCMLNRDDH---------------LYCQRCMRYLG 221
            ..|..::          :|.|||.               :.|:||...||
Zfish   164 LLGDTFI----------LLLRDDGCDESLTRAAAEKRVLVSCRRCSTALG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7326NP_001259695.1 HECT_2 9..381 CDD:286852 54/242 (22%)
ube3dNP_001313339.1 HECT_2 13..378 CDD:286852 54/242 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4784
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1587082at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.