DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7326 and CG10013

DIOPT Version :9

Sequence 1:NP_001259695.1 Gene:CG7326 / 32882 FlyBaseID:FBgn0030970 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_650175.2 Gene:CG10013 / 41494 FlyBaseID:FBgn0038012 Length:465 Species:Drosophila melanogaster


Alignment Length:518 Identity:100/518 - (19%)
Similarity:192/518 - (37%) Gaps:166/518 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LRFDQQVSQSQKTR-----VVVRDYNVY----ISEKPKNQAIDLDSSSESDSEDSDKLMLIRHAQ 76
            :..||.:....:::     :::|..:::    :.....:|.|::..:..|..|.:.:..:|....
  Fly     1 MSLDQVIINCMRSKNWINVLLLRSMDLFQPLLVESSNVSQLIEVSPNGISWHEKNVEYRIIMDEF 65

  Fly    77 YGMDIVC--------LSTFLVSGRNISFRFNYNQIDLASVDGSAVDVPLAPLLLSCQENEPITIN 133
            :  ||:.        ::...:.|.::||.....:|..:.:|...::|.|..|.:........:::
  Fly    66 F--DIITRTNAGDVPITLVEMKGSHVSFGLYLRRIRYSILDALTINVELGELPMCISPYNSCSLH 128

  Fly   134 CRDCRAELVAGRSYRRLREFPSLLVDPTEFFCHNHGPAGKTQPISLVPAETDLFYGLNYVVINFN 198
            |.:|..|::..|.|..::|.|...:.|..:||    |..:   |.:.|:|.:|:|||||:|:   
  Fly   129 CSNCTNEIIGQRQYYHIQEVPITTILPQNYFC----PRNR---IPVYPSEEELYYGLNYLVV--- 183

  Fly   199 EESSCMLNRD-------DHLYCQRCMRYLGLTMFDGAAARIWADAVRWRPAGAATNAP--DRHFF 254
              .|.:|...       ..:.|.||.:.:|..:......:::|||:|:    ...::|  .:..|
  Fly   184 --CSELLGNGVKTIAGRRRVLCSRCKKCVGEFITRDVGVQLYADALRF----VTLDSPLEFKEIF 242

  Fly   255 QNSTLTQLFKRLLHSLWPQPLPQLCLNTSRAVLVTSL-PNRNQQYMFL-------HVVESQLRVL 311
            .:.|.||:..||::.      .::|....|.:.:.:: |:...|.:.|       |::.|:|::.
  Fly   243 GHVTPTQIMMRLVND------GEICGPDQRRLFLKAVRPDGQLQLLHLEMDTKQMHILRSELKLP 301

  Fly   312 RRIRP------------------------NSN------------------------------RLR 322
            ...:|                        :||                              |||
  Fly   302 DIKKPDIDLPMEVDTSSESDVDMNVSDTSSSNSMPQTGDEELAPTPRSTTPRGTPTKTVQYVRLR 366

  Fly   323 CFRACKLYYGVFGANPPLLE------KWQAQQTLPQMDVSPNMFLKIQKRLETNGHL-IPDALST 380
            .||..::.|...|::..|:|      .|..:.|                ||....|| :.|.||.
  Fly   367 GFRGWRVRYLFSGSDRDLIEHDDVYINWTDEGT----------------RLLYISHLMMADLLSE 415

  Fly   381 NCAEEHLQLSYFFYENEDQHDGGVVASDVFTDQMSNVYQKEVDPYETDAGHAS----ESDDEY 439
            ..|.|:|                 |||          .:|:..|..||....|    |||.|:
  Fly   416 FNANENL-----------------VAS----------LEKKPLPTRTDNPRQSCIICESDKEF 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7326NP_001259695.1 HECT_2 9..381 CDD:286852 85/454 (19%)
CG10013NP_650175.2 HECT_2 <125..>256 CDD:303071 38/146 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456942
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4784
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.