DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp39 and Usp20-33

DIOPT Version :9

Sequence 1:NP_573334.1 Gene:Usp39 / 32881 FlyBaseID:FBgn0030969 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_610943.2 Gene:Usp20-33 / 36580 FlyBaseID:FBgn0033916 Length:975 Species:Drosophila melanogaster


Alignment Length:490 Identity:104/490 - (21%)
Similarity:166/490 - (33%) Gaps:184/490 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 GVVGLNNIKANDYCNVVLHALSHVGPLRDYFLQ---------KQSYAHVVRPPGDSVFTLVQRFG 212
            |:|||.||....|.|..|.|||::.|:..||:.         :|| |...:|.|     |.:.:.
  Fly    78 GLVGLQNIANTCYMNSALQALSNLPPMTHYFINCSDLVEYIAEQS-ARRCKPGG-----LAKSYR 136

  Fly   213 ELMRKMW----NPRNFKSHVSPHEMLQAVVLWSSKRFQITEQGDPIDFLSWFLNTLHRAL----- 268
            .||:::|    :|:.|   ::|..:|.. :......|:..:|.|..:||..|::.||..|     
  Fly   137 RLMQEIWQDVDDPKEF---IAPRGILYG-IRTVHPMFRGYQQHDTQEFLRCFMDQLHEELTEQVS 197

  Fly   269 ---KGNKHPNSSILYKIFLGEMKIYTRKMPPVELDD-----AAKAQ------------------- 306
               :....|....|            ::..|.|.||     ||.|.                   
  Fly   198 MLPQTQNQPQYQSL------------QQQQPSETDDENDDEAAPASLSHASESEYDTCESSMSER 250

  Fly   307 ----LLATEEYKD------------------------QVEDKNF-----------------IY-- 324
                ||.||.:..                        |.:.||.                 ::  
  Fly   251 SAEVLLKTEYFVTPCRTNGSNSGLPEGHSVQLQQAPLQHQQKNASSAEQKPIEAARSIISDVFDG 315

  Fly   325 --------LTCD-------------LPPP------------------------PLFTDE----FR 340
                    ||||             ||.|                        ...|:|    :.
  Fly   316 KLLSSVQCLTCDRVSTREETFQDLSLPIPNRDFLNVLHQTHSLSVQSLNAAETSARTNEGWLSWM 380

  Fly   341 ENII------PQVNLYQLLSKFNGTAEKE----YKTYKANFM----KRFEITRLPQFIILYIKRF 391
            .|::      |.|.||..::.|....|.:    |...:.|.:    |...:..||:.:.:::|||
  Fly   381 WNMLRSWIYGPSVTLYDCMASFFSADELKGDNMYSCERCNKLRTGIKYSRVLTLPEVLCIHLKRF 445

  Fly   392 TKNTFFLEKNPTIVNFPIKHVDFGDILGMRQRDKDVKD--TKYNLVANIVHDGDPKKGTYRAHIL 454
            ..:..:..|..:.|.||::..|....:     .||.|.  ..|||.:.|.|.|....|.|.....
  Fly   446 RNDLSYSSKISSDVYFPLEGFDMRPYI-----HKDCKSEVAIYNLSSVICHHGTVGGGHYTCFAR 505

  Fly   455 HKANGQWYEMQDLHVTEILPQMITLTESYIQIYER 489
            :..||:|||..|..|||:..:::...::|:..|.:
  Fly   506 NTLNGKWYEFDDQFVTEVSSELVQSCQAYVLFYHK 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp39NP_573334.1 Peptidase_C19M 39..488 CDD:239134 103/487 (21%)
UCH 158..487 CDD:278850 102/485 (21%)
Usp20-33NP_610943.2 UCH 79..538 CDD:278850 102/485 (21%)
Peptidase_C19 80..>204 CDD:271592 36/133 (27%)
Peptidase_C19R 307..538 CDD:239139 50/235 (21%)
DUSP 560..643 CDD:197831
DUSP 667..755 CDD:197831
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21646
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.