DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp39 and Usp2

DIOPT Version :9

Sequence 1:NP_573334.1 Gene:Usp39 / 32881 FlyBaseID:FBgn0030969 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001285528.1 Gene:Usp2 / 33132 FlyBaseID:FBgn0031187 Length:950 Species:Drosophila melanogaster


Alignment Length:372 Identity:92/372 - (24%)
Similarity:151/372 - (40%) Gaps:84/372 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 GVVGLNNIKANDYCNVVLHALSHVGPLRDYFLQKQSYAHVVRPPGDSVFTLVQRFGELMRKMWNP 221
            |:.||.||....:.|.|:..|||...| ..||:..   |..|........::..|.:|:::||..
  Fly   623 GLCGLRNIGNTCFMNSVIQCLSHTQEL-TRFLRSH---HGSRSLSTKDQQILHEFAKLIQEMWTA 683

  Fly   222 RNFKSH-VSPHEMLQAVVLWSSKRFQITE--QGDPIDFLSWFLNTLHRAL----KG--------- 270
               ..| |:|.|:.:|   :|:|....::  |.|..:||.:||::||.||    ||         
  Fly   684 ---NVHTVTPMELKRA---FSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNL 742

  Fly   271 -------------NKHPNSSILYKIFLGEMKIYTRKMPPVELDDAAKAQLLATEEYKDQVEDKNF 322
                         .:|.| |::..:|:|::                |:.|..|......|....|
  Fly   743 SDNKKADLTWEWYTRHEN-SLVRDLFVGQL----------------KSTLKCTTCGNTSVTFDPF 790

  Fly   323 IYLTCDLPPP---------PLFTDEFRENIIPQVNLYQLLSKFNGTAEKEYKTYKANFMKRFEIT 378
            ..|:..||..         .||   .||.::....:        .|..| .|| :....|.|.|.
  Fly   791 WDLSVPLPSSSRCKLEACLDLF---IREEVLDGDEM--------PTCAK-CKT-RRKCTKSFTIQ 842

  Fly   379 RLPQFIILYIKRFTKNTFFLEKNPTIVNFPIKHVDFGDILGMRQRDKDVKDTKYNLVANIVHDGD 443
            |.|:::::::|||::..:  .|...||.||....:..  :|....:.: .:..|:|.|...|.|.
  Fly   843 RFPKYLVIHLKRFSETRW--SKLSNIVEFPTSDSELN--MGSYGANSN-SNVHYSLYAISNHMGS 902

  Fly   444 PKKGTYRAHILHKANGQWYEMQDLHVTEILPQ-MITLTESYIQIYER 489
            ...|.|.|...|..:.:|:|..|..|::.|.: .:..:.:||..|||
  Fly   903 TAGGHYVALCKHPVSRKWHEFNDNIVSDALSENHLVSSSAYILFYER 949

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp39NP_573334.1 Peptidase_C19M 39..488 CDD:239134 89/369 (24%)
UCH 158..487 CDD:278850 88/367 (24%)
Usp2NP_001285528.1 UCH 624..947 CDD:278850 88/367 (24%)
Peptidase_C19R 626..948 CDD:239139 88/366 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21646
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.