DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp39 and CG32544

DIOPT Version :9

Sequence 1:NP_573334.1 Gene:Usp39 / 32881 FlyBaseID:FBgn0030969 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001259694.1 Gene:CG32544 / 318082 FlyBaseID:FBgn0052544 Length:186 Species:Drosophila melanogaster


Alignment Length:131 Identity:25/131 - (19%)
Similarity:43/131 - (32%) Gaps:28/131 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 VRPPGDSVFTLVQRFGELMRKMWNPRNFKSHVSPHEMLQAVVLWSSKRFQITEQGDPIDFLSWFL 261
            ::||..:         |..||  .....:..::..|..:||:| ..:...:...|..:..|:..|
  Fly    23 LQPPDPA---------EFERK--RQARLEHELAEQEAAEAVLL-EQQDESLGNVGGKLGELNSIL 75

  Fly   262 NTLHRALKGNKHPNSSILYKIFL----------------GEMKIYTRKMPPVELDDAAKAQLLAT 310
            ::..:.|...|......|..||.                |.:.....:.|||:....||....|.
  Fly    76 SSTQQKLNRFKQTACGSLTNIFARASSGSVDLSAGIGRSGSIASTQEERPPVQEQPLAKPPPTAA 140

  Fly   311 E 311
            |
  Fly   141 E 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp39NP_573334.1 Peptidase_C19M 39..488 CDD:239134 25/131 (19%)
UCH 158..487 CDD:278850 25/131 (19%)
CG32544NP_001259694.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2026
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.