DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and SPS19

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_014197.2 Gene:SPS19 / 855518 SGDID:S000005146 Length:292 Species:Saccharomyces cerevisiae


Alignment Length:253 Identity:70/253 - (27%)
Similarity:120/253 - (47%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GKVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQL------VAFDPVHIQPL-QLDLSG 64
            |||..|||....|.:...:.|...|.....|.|..|:.:|.      :|.|...:..: .:|:..
Yeast    24 GKVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAIANVDVRN 88

  Fly    65 WQ----AVREGLAKVPLLDGLVNNAGVAIIKPFEELTEQDFDTHFDVNIKAVFNVTQSLLPRLKD 125
            ::    ||::.:.|...:|.::..|....:..|..|:...|.:..|:::...||..::.|..||.
Yeast    89 FEQVENAVKKTVEKFGKIDFVIAGAAGNFVCDFANLSPNAFKSVVDIDLLGSFNTAKACLKELKK 153

  Fly   126 G-ASIVNVSSIASSRSFG----GHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVV----- 180
            . .||:.||  |:...:|    ||.  .|.||.:|:|.|:||:||||..||.|.:.|..:     
Yeast   154 SKGSILFVS--ATFHYYGVPFQGHV--GAAKAGIDALAKNLAVELGPLGIRSNCIAPGAIDNTEG 214

  Fly   181 LTKMGADNWSDPAKSGPLLAHIPLNRFCEVQEVVDATGYLLSSKSSFVNGHHILLEGG 238
            |.::....:.:.|     ||.|||.|....:::.::|.|:.|..:|:|.|..::::||
Yeast   215 LKRLAGKKYKEKA-----LAKIPLQRLGSTRDIAESTVYIFSPAASYVTGTVLVVDGG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 70/253 (28%)
SPS19NP_014197.2 TER_DECR_SDR_a 22..270 CDD:187627 70/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.