DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and YMR226C

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_013953.1 Gene:YMR226C / 855266 SGDID:S000004839 Length:267 Species:Saccharomyces cerevisiae


Alignment Length:264 Identity:79/264 - (29%)
Similarity:125/264 - (47%) Gaps:45/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LAGKVILVTGAGAGIGQALVKQLASAG---ATVIAVARKPEQLQQL-----VAFDPVHIQPLQLD 61
            ||.|.:|:|||.||||:|...:...|.   ..:|..||:.|:|::|     ..|....:...|||
Yeast    11 LAKKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVHVAQLD 75

  Fly    62 LSGWQAVREGLAKVPL----LDGLVNNAGVAI-IKPFEELTEQDFDTHFDVNIKAVFNVTQSLLP 121
            ::..:.::..:..:|.    :|.||||||.|: .....::..:|....||.|:.|:.|:||::||
Yeast    76 ITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALINITQAVLP 140

  Fly   122 --RLKDGASIVNVSSIASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLTKM 184
              :.|:...|||:.|||...::...:.|.|:|.|:.:.|.||..||...||||..:.|.:|.|:.
Yeast   141 IFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELINTKIRVILIAPGLVETEF 205

  Fly   185 GADNW---SDPAK-----SGPLLAHIPLNRFCEVQEVVDATGYLLSSKSSFV------------N 229
            ....:   .:.||     :.||:|          .:|.|...|..|.|.:.|            :
Yeast   206 SLVRYRGNEEQAKNVYKDTTPLMA----------DDVADLIVYATSRKQNTVIADTLIFPTNQAS 260

  Fly   230 GHHI 233
            .|||
Yeast   261 PHHI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 79/264 (30%)
YMR226CNP_013953.1 SDR_c5 14..266 CDD:187604 77/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.