DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and AYR1

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_012142.3 Gene:AYR1 / 854682 SGDID:S000001386 Length:297 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:67/200 - (33%)
Similarity:98/200 - (49%) Gaps:18/200 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQL-VAFDPVHIQPLQLDLSGWQAV--R 69
            |:.:||||..|||..:.|:||..|..|.|.||:.|.:.|| :.|....|:|.:||:|..:.:  .
Yeast    10 KIAVVTGASGGIGYEVTKELARNGYLVYACARRLEPMAQLAIQFGNDSIKPYKLDISKPEEIVTF 74

  Fly    70 EGLAKVPLLDG----LVNNAGVAIIKPFEELTEQDFDTHFDVNIKAVFNVTQSLLPRL-KDGASI 129
            .|..:..|.||    |.||||.:...|..:.|:...:..|.||:....|:.:.|...| |...:|
Yeast    75 SGFLRANLPDGKLDLLYNNAGQSCTFPALDATDAAVEQCFKVNVFGHINMCRELSEFLIKAKGTI 139

  Fly   130 VNVSSIASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRV-NSVNPTVVLTKMGADNWSDPA 193
            |...|:|...||...:.|||:|||:....:.|.||:.|..:|| |::...|.         :|.|
Yeast   140 VFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPFNVRVINAITGGVA---------TDIA 195

  Fly   194 KSGPL 198
            ...||
Yeast   196 DKRPL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 66/199 (33%)
AYR1NP_012142.3 17beta-HSD-like_SDR_c 10..256 CDD:187632 66/199 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2478
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.