DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and ATA1

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_189882.1 Gene:ATA1 / 823352 AraportID:AT3G42960 Length:272 Species:Arabidopsis thaliana


Alignment Length:261 Identity:77/261 - (29%)
Similarity:121/261 - (46%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQLVAFD----PVHIQ-PLQLDLSGWQA 67
            ||.::||...|||.|..:.....||.|| ||...|....|||..    .||.. ..:.|:..  |
plant    11 KVAIITGGARGIGAATARLFTENGAYVI-VADILENEGILVAESIGGCYVHCDVSKEADVEA--A 72

  Fly    68 VREGLAKVPLLDGLVNNAGVAIIKPFEELTEQDFD---THFDVNIKAVF----NVTQSLLPRLKD 125
            |...:.:...||.:.||||:::.:  ..:...|.|   ....||:..|.    :..::::...:.
plant    73 VELAMRRKGRLDVMFNNAGMSLNE--GSIMGMDVDMVNKLVSVNVNGVLHGIKHAAKAMIKGGRG 135

  Fly   126 GASIVNVSSIASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLT-------- 182
            |:.|...||.......||| ||:.:|.|::.:.::.|.|||...|||||::|..|.|        
plant   136 GSIICTSSSSGLMGGLGGH-AYTLSKGAINGVVRTTACELGSHGIRVNSISPHGVPTDILVNAYR 199

  Fly   183 ------KMGADNWSD-PAKSGPLLAHIPLNRFCEVQEVVDATGYLLSSKSS-FVNGHHILLEGGY 239
                  |:.....:| .|:.|.||.    .|...|::|..|..:|.|.:|| |:.||:::::|||
plant   200 KFLNHDKLNVAEVTDIIAEKGSLLT----GRAGTVEDVAQAALFLASQESSGFITGHNLVVDGGY 260

  Fly   240 S 240
            :
plant   261 T 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 77/261 (30%)
ATA1NP_189882.1 PLN02253 4..268 CDD:177895 77/261 (30%)
NADB_Rossmann 7..261 CDD:304358 76/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051625at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.