DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and AT3G01980

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001078090.1 Gene:AT3G01980 / 821069 AraportID:AT3G01980 Length:296 Species:Arabidopsis thaliana


Alignment Length:290 Identity:64/290 - (22%)
Similarity:125/290 - (43%) Gaps:62/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQLV---------AFDPVHIQPLQL--- 60
            |.:|:|..|..:.:.:...||..|..::.:..: ..|:.:|         || |..:..|.:   
plant     6 KRVLMTSNGDEVSRNIAFHLAKHGCKLVMMGNE-GSLRSIVDKIRDSIEGAF-PADVIALDMESD 68

  Fly    61 -------------DLSGW------QAVREGL------AKVPLLDGLVNNAGV-------AIIKPF 93
                         :|||.      ....:||      ..:||:...|:::.:       ..::..
plant    69 SEVAFHAAVQKAWELSGHFDAFLNSYTYQGLICFLFFTTLPLMLLCVDHSFIQQSFFLAGKVQDI 133

  Fly    94 EELTEQDFDTHFDVNIKAVFNVTQSLLPRLKD---GASIVNVSSIASSRS--FGGHTAYSATKAA 153
            .::::.:|.....:|:.|.:.:.:::..|:||   |.|||.:::|||...  :.|..||::|.||
plant   134 LQVSQDEFHRITKINLTAPWFLLKAVATRMKDHGSGGSIVFMATIASGERALYPGADAYASTSAA 198

  Fly   154 LDSLTKSLALELGPRKIRVNSVNPTVVL-----TKMGADNWSDPAKSGPLLAHIPLNRFCEVQ-E 212
            :..|.::.|:.||..|||||.::..:.|     ..:|.|......|..     .||.::.... :
plant   199 IHQLVRASAMSLGKHKIRVNMISRGLHLDDEYTASVGRDRAQKLVKDA-----APLGQWLNPDTD 258

  Fly   213 VVDATGYLLSSKSSFVNGHHILLEGGYSVS 242
            :.....||:|..|.|:.|..:|::|..|::
plant   259 LYSTVIYLISDGSRFMTGTTVLVDGAQSLT 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 64/288 (22%)
AT3G01980NP_001078090.1 fabG 1..287 CDD:235546 63/287 (22%)
SDR_c 21..282 CDD:212491 58/267 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051625at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.