DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and LOC688321

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_038943481.1 Gene:LOC688321 / 688321 RGDID:1590050 Length:282 Species:Rattus norvegicus


Alignment Length:245 Identity:108/245 - (44%)
Similarity:154/245 - (62%) Gaps:4/245 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWTDLAGKVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQLVAFDPVHIQPLQLDLSGW 65
            |..:.:|...||||||.|||:...|.|.::||.|:||.|....|..|....| .|:|:.:||..|
  Rat    39 MKPNFSGLRALVTGAGKGIGRDTAKALHASGAKVVAVTRTNADLVSLAKECP-GIEPVCVDLGDW 102

  Fly    66 QAVREGLAKVPLLDGLVNNAGVAIIKPFEELTEQDFDTHFDVNIKAVFNVTQSLLPRLKD---GA 127
            :|..:.|..:..:|.||||||||:::||.|.|::.||..|:||::||..|:|.:...:.:   ..
  Rat   103 EATEKALGGIGPVDLLVNNAGVALLQPFIESTKEIFDRSFNVNVRAVLQVSQIVAKGMINRGVAG 167

  Fly   128 SIVNVSSIASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLTKMGADNWSDP 192
            ||||:||:.:..::.|.|.|.:||.|:..|||::|:||||.||||||||||||||.||....:||
  Rat   168 SIVNISSMVAYVTYPGLTTYCSTKGAITMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADP 232

  Fly   193 AKSGPLLAHIPLNRFCEVQEVVDATGYLLSSKSSFVNGHHILLEGGYSVS 242
            ..:..||...||.:|.||::||::..:|||..|:...|..||::.||..|
  Rat   233 KFAKKLLKRHPLRKFAEVEDVVNSILFLLSDSSASTTGSGILVDSGYLAS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 107/243 (44%)
LOC688321XP_038943481.1 XR_like_SDR_c 39..282 CDD:187609 107/243 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337384
Domainoid 1 1.000 205 1.000 Domainoid score I2818
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3529
OMA 1 1.010 - - QHG52160
OrthoDB 1 1.010 - - D1051625at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46391
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44252
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1266
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.