DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and DCXR

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_057370.1 Gene:DCXR / 51181 HGNCID:18985 Length:244 Species:Homo sapiens


Alignment Length:239 Identity:118/239 - (49%)
Similarity:157/239 - (65%) Gaps:6/239 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LAGKVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQLVAFDPVHIQPLQLDLSGWQAVR 69
            |||:.:||||||.|||:..|:.|.:.||.|:||:|....|..||...| .|:|:.:||..|:|..
Human     5 LAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECP-GIEPVCVDLGDWEATE 68

  Fly    70 EGLAKVPLLDGLVNNAGVAIIKPFEELTEQDFDTHFDVNIKAVFNVTQ----SLLPRLKDGASIV 130
            ..|..|..:|.|||||.||:::||.|:|::.||..|:||::||..|:|    .|:.|...|| ||
Human    69 RALGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGA-IV 132

  Fly   131 NVSSIASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLTKMGADNWSDPAKS 195
            ||||..|.|:...|:.|.:||.|||.|||.:||||||.|||||:||||||:|.||...||||.|:
Human   133 NVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKA 197

  Fly   196 GPLLAHIPLNRFCEVQEVVDATGYLLSSKSSFVNGHHILLEGGY 239
            ..:|..|||.:|.||:.||:|..:|||.:|....|..:.:|||:
Human   198 KTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGF 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 118/239 (49%)
DCXRNP_057370.1 XR_like_SDR_c 1..244 CDD:187609 118/239 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143651
Domainoid 1 1.000 199 1.000 Domainoid score I3061
eggNOG 1 0.900 - - E1_KOG1207
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H22964
Inparanoid 1 1.050 210 1.000 Inparanoid score I3675
Isobase 1 0.950 - 1.057542 Normalized mean entropy S1884
OMA 1 1.010 - - QHG52160
OrthoDB 1 1.010 - - D1051625at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - oto91718
orthoMCL 1 0.900 - - OOG6_105139
Panther 1 1.100 - - LDO PTHR44252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2478
SonicParanoid 1 1.000 - - X1266
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1817.750

Return to query results.
Submit another query.