DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and CG31549

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster


Alignment Length:244 Identity:87/244 - (35%)
Similarity:130/244 - (53%) Gaps:13/244 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQ----LVAFDPVHIQPLQLDLSG---- 64
            |||:||||.:|||.:....||..|..::.|.|..|:|::    :||........||.|::.    
  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAEV 71

  Fly    65 WQAVREGLAKVPLLDGLVNNAGVAIIKPFEELTEQDFDTHFDVNIKAVFNVTQSLLPRL-KDGAS 128
            .|.|...|||...:|.||||||:......|..:.:.||...:.|:::::.:|....|.| |...:
  Fly    72 QQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVKTKGN 136

  Fly   129 IVNVSSIASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLTKMGADNWSDPA 193
            ||||||:...|:|.|..||:.:|||:|..|..:||||.|:.:|||:|||.|::|.:......|..
  Fly   137 IVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGGMDEE 201

  Fly   194 KSGPLLAHI----PLNRFCEVQEVVDATGYLLSSKSSFVNGHHILLEGG 238
            .....|.|.    .|.|..:|:||..|..:|.|.::||..|..:.::||
  Fly   202 TYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 87/244 (36%)
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 87/244 (36%)
fabG 4..251 CDD:235975 87/244 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I1866
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I1506
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.